Structure of PDB 7oht Chain B

Receptor sequence

>7ohtB (length=350) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]

APRHGHLGFLPRKRAASIRARVKAFPKDDRSKPVALTSFLGYKAGMTTIV
RDLDRPGSKFHKREVVEAVTVVDTPPVVVVGVVGYVETPRGLRSLTTVWA
EHLSDEVKRRFYKNWYKSKKKAFTKYSAKYAQDGAGIERELARIKKYASV
VRVLVHTQIRKTPLAQKKAHLAEIQLNGGSISEKVDWAREHFEKTVAVDS
VFEQNEMIDAIAVTKGHGFEGKVACIGAWHGQRGYHSRTSINHKIYRVGK
GDDEANGATSFDRTKKTITPMGGFVHYGEIKNDFIMVKGCIPGNRKRIVT
LRKSLYTNTSRKALEEVSLKWIDTASKFGKGRFQTPAEKHAFMGTLKKDL

3D structure

PDB

7oht Analysis of subunit folding contribution of three yeast large ribosomal subunit proteins required for stabilisation and processing of intermediate nuclear rRNA precursors.

Chain

Resolution

4.7 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	B	A8 P9 R10 G12 H13 L14 G15 F16 P18 K20 R21 R26 R28 K30 M53 R62 S65 Y92 T95 R97 G98 L99 R100 S101 T104 W106 R116 F118 K120 N121 Y123 S125 K126 K128 F130 K132 Y133 K153 Y154 K174 K175 L178 A179 E180 T221 K222 G223 G225 F226 A250 C251 I252 G253 A254 W255 H256 Q269 Y272 S274 R275 T276 I278 N279 M308 G309 H313 Y314 K325 G326 C327 N331 R332 K333 R334 R348 S363 K364 F365 K367 R369 P373 K376 M380 L383 K384 K385	A1 P2 R3 G5 H6 L7 G8 F9 P11 K13 R14 R19 R21 K23 M46 R55 S58 Y85 T88 R90 G91 L92 R93 S94 T97 W99 R109 F111 K113 N114 Y116 S118 K119 K121 F123 K125 Y126 K146 Y147 K167 K168 L171 A172 E173 T214 K215 G216 G218 F219 A224 C225 I226 G227 A228 W229 H230 Q232 Y235 S237 R238 T239 I241 N242 M271 G272 H276 Y277 K288 G289 C290 N294 R295 K296 R297 R311 S326 K327 F328 K330 R332 P336 K339 M343 L346 K347 K348

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0002181	cytoplasmic translation
GO:0006364	rRNA processing
GO:0006412	translation
GO:0006414	translational elongation
GO:1990145	maintenance of translational fidelity

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7oht, PDBe:7oht, PDBj:7oht
PDBsum	7oht
PubMed	34813592
UniProt	P14126\|RL3_YEAST Large ribosomal subunit protein uL3 (Gene Name=RPL3)

[Back to BioLiP]