Structure of PDB 7o4k Chain B

Receptor sequence

>7o4kB (length=71) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]

ASFLKEAFRVHICGICGLMTVIAKLNHNQFECKGCDNKIDIYQIHIPYAA
KLLFQELMAMNITPRLYTDRS

3D structure

PDB

7o4k Structure of RNA polymerase II pre-initiation complex at 2.9 angstrom defines initial DNA opening.

Chain

Resolution

3.6 Å

3D
structure

Enzymatic activity

Enzyme Commision number

2.7.7.6: DNA-directed RNA polymerase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	B	C1163 C1166 C1182 C1185	C13 C16 C32 C35

Gene Ontology

	Molecular Function
GO:0001055	RNA polymerase II activity
GO:0003677	DNA binding
GO:0003729	mRNA binding
GO:0003899	DNA-directed 5'-3' RNA polymerase activity
GO:0003968	RNA-dependent RNA polymerase activity
GO:0005515	protein binding
GO:0008270	zinc ion binding
GO:0016779	nucleotidyltransferase activity
GO:0032549	ribonucleoside binding
GO:0034062	5'-3' RNA polymerase activity
GO:0046872	metal ion binding

	Biological Process
GO:0001172	RNA-templated transcription
GO:0006351	DNA-templated transcription
GO:0006366	transcription by RNA polymerase II
GO:0006367	transcription initiation at RNA polymerase II promoter
GO:0006368	transcription elongation by RNA polymerase II

	Cellular Component
GO:0000428	DNA-directed RNA polymerase complex
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005665	RNA polymerase II, core complex
GO:0005739	mitochondrion
GO:0010494	cytoplasmic stress granule

External links

PDB	RCSB:7o4k, PDBe:7o4k, PDBj:7o4k
PDBsum	7o4k
PubMed	34133942
UniProt	P08518\|RPB2_YEAST DNA-directed RNA polymerase II subunit RPB2 (Gene Name=RPB2)