Structure of PDB 7nyu Chain B

Receptor sequence
>7nyuB (length=159) Species: 37762 (Escherichia coli B) [Search protein sequence]
NDMVNWGRKNSIWPYNFGLSCCYVEMVTSFTAVHLRASPRQADLMVVAGT
CFTKMAPVIQRLYDQMLEPKWVISMGACANSGGMYDIYSVVQGVDKFIPV
DVYIPGCPPRPEAYMQALMLLQESIGKEQGVYRANMQSERERKRGERIAV
TNLRTPDEI
3D structure
PDB7nyu Structure of Escherichia coli respiratory complex I reconstituted into lipid nanodiscs reveals an uncoupled conformation.
ChainB
Resolution3.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 7.1.1.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 SF4 B C63 C64 T101 C129 C158 P159 C21 C22 T50 C78 C107 P108
Gene Ontology
Molecular Function
GO:0003954 NADH dehydrogenase activity
GO:0005506 iron ion binding
GO:0008137 NADH dehydrogenase (ubiquinone) activity
GO:0046872 metal ion binding
GO:0048038 quinone binding
GO:0050136 NADH:ubiquinone reductase (non-electrogenic) activity
GO:0051536 iron-sulfur cluster binding
GO:0051539 4 iron, 4 sulfur cluster binding
Biological Process
GO:0009060 aerobic respiration
GO:0015990 electron transport coupled proton transport
GO:0022904 respiratory electron transport chain
Cellular Component
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0030964 NADH dehydrogenase complex
GO:0045271 respiratory chain complex I

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7nyu, PDBe:7nyu, PDBj:7nyu
PDBsum7nyu
PubMed34308841
UniProtP0AFC7|NUOB_ECOLI NADH-quinone oxidoreductase subunit B (Gene Name=nuoB)

[Back to BioLiP]