Structure of PDB 7nny Chain B

Receptor sequence

>7nnyB (length=297) Species: 83332 (Mycobacterium tuberculosis H37Rv)

VIRHFLRDDDLSPAEQAEVLELAAELKKDPVSRRPLQGPRGVAVIFDKNS
TRTRFSFELGIAQLGGHAVVVDSGSTQLGRDETLQDTAKVLSRYVDAIVW
RTFGQERLDAMASVATVPVINALSDEFHPCQVLADLQTIAERKGALRGLR
LSYFGDGANNMAHSLLLGGVTAGIHVTVAAPEGFLPDPSVRAAAERRAQD
TGASVTVTADAHAAAAGADVLVTDTWTRVKPFRPFQLNSRLLALADSDAI
VLHCLPAHRGDEITDAVMDGPASAVWDEAENRLHAQKALLVWLLERS

3D structure

• PDB: 7nny A fragment-based approach to assess the ligandability of ArgB, ArgC, ArgD and ArgF in the L-arginine biosynthetic pathway of Mycobacterium tuberculosis
• Chain: B
• Resolution: 1.57 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): R101 H128 Q131 D224 C264 R292
• Catalytic site (residue number reindexed from 1): R101 H128 Q131 D224 C254 R282
• Enzyme Commision number: 2.1.3.3: ornithine carbamoyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	1NP	B	E82 V90 Y94	E82 V90 Y94
BS02	1NP	B	T76 L78	T76 L78
BS03	1NP	B	T51 R52	T51 R52

Gene Ontology

Molecular Function

• GO:0004585 ornithine carbamoyltransferase activity
• GO:0016597 amino acid binding
• GO:0016740 transferase activity
• GO:0016743 carboxyl- or carbamoyltransferase activity

Biological Process

• GO:0006520 amino acid metabolic process
• GO:0006526 L-arginine biosynthetic process
• GO:0006591 ornithine metabolic process
• GO:0019240 citrulline biosynthetic process
• GO:0042450 arginine biosynthetic process via ornithine

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:7nny, PDBe:7nny, PDBj:7nny
• PDBsum: 7nny
• UniProt: P9WIT9|OTC_MYCTU Ornithine carbamoyltransferase (Gene Name=argF)