Structure of PDB 7nml Chain B

Receptor sequence

>7nmlB (length=133) Species: 9606 (Homo sapiens) [Search protein sequence]

CGLVASNLNLKPGECLRVRGEVAPDAKSFVLNLGKDSNNLCLHFNPRFNA
HGDANTIVCNSKDGGAWGTEQREAVFPFQPGSVAEVCITFDQANLTVKLP
DGYEFKFPNRLNLEAINYMAADGDFKIKCVAFD

3D structure

PDB

7nml Galectin-1 in complex with 4-Amino-6-chloro-1,3-benzenedisulfonamide

Chain

Resolution

1.43 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	I7B	B	D92 Q93 A94	D91 Q92 A93

Gene Ontology

	Biological Process
GO:0002317	plasma cell differentiation
GO:0006915	apoptotic process
GO:0007165	signal transduction
GO:0031295	T cell costimulation
GO:0042981	regulation of apoptotic process
GO:0043065	positive regulation of apoptotic process
GO:0043123	positive regulation of canonical NF-kappaB signal transduction
GO:0045445	myoblast differentiation
GO:0046598	positive regulation of viral entry into host cell
GO:0050729	positive regulation of inflammatory response
GO:0098609	cell-cell adhesion
GO:2000329	negative regulation of T-helper 17 cell lineage commitment
GO:2001200	positive regulation of dendritic cell differentiation

	Cellular Component
GO:0005576	extracellular region
GO:0005615	extracellular space
GO:0005737	cytoplasm
GO:0005788	endoplasmic reticulum lumen
GO:0005829	cytosol
GO:0005886	plasma membrane
GO:0062023	collagen-containing extracellular matrix
GO:0070062	extracellular exosome
GO:1990724	galectin complex

External links

PDB	RCSB:7nml, PDBe:7nml, PDBj:7nml
PDBsum	7nml
PubMed
UniProt	P09382\|LEG1_HUMAN Galectin-1 (Gene Name=LGALS1)