Structure of PDB 7niq Chain B

Receptor sequence

>7niqB (length=673) Species: 10090 (Mus musculus)

ELQLRPYQMEVAQPALDGKNIIICLPTGSGKTRVAVYITKDHLDKKKQAS
ESGKVIVLVNKVMLAEQLFRKEFNPYLKKWYRIIGLSGDTQLKISFPEVV
KSYDVIISTAQILENSLLNLESGDDDGVQLSDFSLIIIDECHHTNKEAVY
NNIMRRYLKQKLRNNDLKKQNKPAIPLPQILGLTASPGVGAAKKQSEAEK
HILNICANLDAFTIKTVKENLGQLKHQIKEPCKKFVIADDTRENPFKEKL
LEIMASIQTYCQKSPMSDFGTQHYEQWAIQMEKKAAKDGNRKDRVCAEHL
RKYNEALQINDTIRMIDAYSHLETFYTDEKEKKFAVLNDETDEFLMNLFF
DNKKMLKKLAENPKEKLIKLRNTILEQFTRSERGIIFTKTRQSTYALSQW
IMENAKFAEVGVKAHHLIGAGHSSEVKPMTQTEQKEVISKFRTGEINLLI
ATTVAEEGLDIKECNIVIRYGLVTNEIAMVQARGRARADESTYVLVTSSG
SGVTEREIVNDFREKMKYKAINRVQNMKPEEYAHKILELQVQSILEKKMK
VKRSIAKQYNDNPSLITLLCKNCSMLVCSGENIHVIEKMHHVNMTPEFKG
LYIVRENKTNGEIICKCGQAWGTMMVHKGLDLPCLKIRNFVVNFKNNSPK
KQYKKWVELPIRFPDLDYSEYCL

3D structure

• PDB: 7niq MDA5 disease variant M854K prevents ATP-dependent structural discrimination of viral and cellular RNA.
• Chain: B
• Resolution: 4.3 Å

Enzymatic activity

• Enzyme Commision number: 3.6.4.13: RNA helicase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	B	K451 E452 H578 Q581 T811 N812 R843 H927 K983 K1002	K146 E147 H273 Q276 T474 N475 R506 H590 K636 K655
BS02	rna	B	V367 G393 R728 G756 V791 E924	V62 G88 R391 G419 V454 E587
BS03	ADP	B	Q308 L309 R310 Q313 T332 G333 S334 G335 K336 T337 R338	Q3 L4 R5 Q8 T27 G28 S29 G30 K31 T32 R33
BS04	ALF	B	T332 K336 E445	T27 K31 E140
BS05	ZN	B	C907 C910 C962	C570 C573 C615

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0003723 RNA binding
• GO:0003724 RNA helicase activity
• GO:0003725 double-stranded RNA binding
• GO:0003727 single-stranded RNA binding
• GO:0004386 helicase activity
• GO:0005515 protein binding
• GO:0005524 ATP binding
• GO:0008270 zinc ion binding
• GO:0016787 hydrolase activity
• GO:0016887 ATP hydrolysis activity
• GO:0019904 protein domain specific binding
• GO:0038187 pattern recognition receptor activity
• GO:0042802 identical protein binding
• GO:0043021 ribonucleoprotein complex binding
• GO:0046872 metal ion binding

Biological Process

• GO:0002376 immune system process
• GO:0009615 response to virus
• GO:0016925 protein sumoylation
• GO:0032727 positive regulation of interferon-alpha production
• GO:0032728 positive regulation of interferon-beta production
• GO:0032755 positive regulation of interleukin-6 production
• GO:0032760 positive regulation of tumor necrosis factor production
• GO:0039530 MDA-5 signaling pathway
• GO:0045071 negative regulation of viral genome replication
• GO:0045087 innate immune response
• GO:0051259 protein complex oligomerization
• GO:0051607 defense response to virus
• GO:0060337 type I interferon-mediated signaling pathway
• GO:0060760 positive regulation of response to cytokine stimulus
• GO:0071360 cellular response to exogenous dsRNA
• GO:0098586 cellular response to virus
• GO:0140374 antiviral innate immune response

Cellular Component

• GO:0005634 nucleus
• GO:0005737 cytoplasm
• GO:0005739 mitochondrion

External links

• PDB: RCSB:7niq, PDBe:7niq, PDBj:7niq
• PDBsum: 7niq
• PubMed: 34795277
• UniProt: Q8R5F7|IFIH1_MOUSE Interferon-induced helicase C domain-containing protein 1 (Gene Name=Ifih1)