Structure of PDB 7nfx Chain B

Receptor sequence

>7nfxB (length=394) Species: 9986 (Oryctolagus cuniculus)

SHRKFSAPRHGSLGFLPRKRSSRHRGKVKSFPKDDPSKPVHLTAFLGYKA
GMTHIVREVDRPGSKVNKKEVVEAVTIVETPPMVVVGIVGYVETPRGLRT
FKTVFAEHISDECKRRFYKNWHKSKKKAFTKYCKKWQDDAGKRQLDKDFS
SMKKYCQVIRVLAHTQMRLLPLRQKKAHLMEIQVNGGTVAEKLDWARERL
EQQVPVSQVFGQDEMIDVIGVTKGKGYKGVTSRWHTKKLPRKTHRGLRKV
ACIGAWHPARVAFSVARAGQKGYHHRTEINKKIYKIGQGYLIKDGKLIKN
NASTDYDLSDKSINPLGGFVHYGEVTNDFVMLKGCVVGTKKRVLTLRKSL
LVQTKRRALEKIDLKFIDTTSKFGHGRFQTVEEKKAFMGPLKKD

3D structure

• PDB: 7nfx Receptor compaction and GTPase rearrangement drive SRP-mediated cotranslational protein translocation into the ER.
• Chain: B
• Resolution: 3.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	B	S2 H3 R4 K5 F6 S7 A8 P9 R10 H11 G12 S13 L14 G15 F16 P18 R19 K20 R21 S23 H25 R26 K30 S31 M53 T54 H55 R62 S65 A75 Y92 T95 P96 R97 L99 R100 T101 F102 F106 R116 R117 F118 Y119 K120 N121 H123 K124 K126 K128 A129 F130 K132 Y133 Y156 R169 R174 Q175 K176 K177 E182 T223 K224 G225 K226 G227 Y228 K229 G230 R234 K238 K239 R242 K243 T244 H245 R246 G247 L248 R249 K250 A252 C253 I254 G255 A256 W257 H258 P259 A260 R261 V262 S265 R268 A269 Q271 Y274 H276 R277 T278 E279 I280 N281 L317 G318 V321 H322 G324 G335 C336 V337 V338 T340 K341 K342 R343 L352 S372 K373 F374 G375 H376 K385 M389 L392 K393	S1 H2 R3 K4 F5 S6 A7 P8 R9 H10 G11 S12 L13 G14 F15 P17 R18 K19 R20 S22 H24 R25 K29 S30 M52 T53 H54 R61 S64 A74 Y91 T94 P95 R96 L98 R99 T100 F101 F105 R115 R116 F117 Y118 K119 N120 H122 K123 K125 K127 A128 F129 K131 Y132 Y155 R168 R173 Q174 K175 K176 E181 T222 K223 G224 K225 G226 Y227 K228 G229 R233 K237 K238 R241 K242 T243 H244 R245 G246 L247 R248 K249 A251 C252 I253 G254 A255 W256 H257 P258 A259 R260 V261 S264 R267 A268 Q270 Y273 H275 R276 T277 E278 I279 N280 L316 G317 V320 H321 G323 G334 C335 V336 V337 T339 K340 K341 R342 L351 S371 K372 F373 G374 H375 K384 M388 L391 K392
BS02	peptide	B	K294 D295	K293 D294

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005634 nucleus
• GO:0005730 nucleolus
• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7nfx, PDBe:7nfx, PDBj:7nfx
• PDBsum: 7nfx
• PubMed: 34020957
• UniProt: G1TL06|RL3_RABIT Large ribosomal subunit protein uL3 (Gene Name=RPL3)