Structure of PDB 7n9d Chain B

Receptor sequence

>7n9dB (length=256) Species: 1291540 (Methanomethylophilus alvi)

VPRGSHMILIKLGGSVITDKSEYHKFNKETVSRLADEIRRSGQDVMVVHG
AGSFGHVIAKKYAIQDGHVDDGQIPAAARAMCDTRELSSMVVEELLAQGI
PAVSVAPGSCFVMEDGKLIVDNEEPIRRLADLGIMPVMFGDVVPDRKKGF
AIVSGDQCMEVLCRMFDPEKVVFVSDIDGLYTADPKTDKKARLIGEVTRK
KLDEALTDVTGGVHSKMEAMLRMTDRNRRCYLVNGNAPNRLYSLLKGETV
TCTVAK

3D structure

• PDB: 7n9d Molecular Basis for the Substrate Promiscuity of Isopentenyl Phosphate Kinase from Candidatus methanomethylophilus alvus .
• Chain: B
• Resolution: 2.1 Å

Enzymatic activity

• Enzyme Commision number: 2.7.4.26: isopentenyl phosphate kinase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ADP	B	G8 S9 K14 S169 D170 I171 Y175 A177 D178 P179 K180 L200 T201 V212 K215	G14 S15 K20 S175 D176 I177 Y181 A183 D184 P185 K186 L206 T207 V213 K216
BS02	0XI	B	K5 G44 A45 G49 H50 A53 A74 G134 D135 V136 I146 S148 G149 T209	K11 G50 A51 G55 H56 A59 A80 G140 D141 V142 I152 S154 G155 T210

Gene Ontology

Molecular Function

• GO:0005524 ATP binding
• GO:0016301 kinase activity
• GO:0102043 isopentenyl phosphate kinase activity

Biological Process

• GO:0008299 isoprenoid biosynthetic process
• GO:0016310 phosphorylation

Cellular Component

• GO:0005829 cytosol

External links

• PDB: RCSB:7n9d, PDBe:7n9d, PDBj:7n9d
• PDBsum: 7n9d
• PubMed: 34905349
• UniProt: M9SEQ1