Structure of PDB 7mwl Chain B |
>7mwlB (length=105) Species: 9606 (Homo sapiens) [Search protein sequence] |
IATPEEVRLPLQHGWRREVRIKKGSHRWQGETWYYGPCGKRMKQFPEVIK YLSRNVVHSVRREHFSFSPRMPVGDFFEERDTPEGLQWVQLSAEEIPSRI QAITG |
|
PDB | 7mwl The TAM domain of BAZ2A in complex with a 12mer mCG DNA |
Chain | B |
Resolution | 1.84 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
dna |
B |
K588 Q589 |
K43 Q44 |
|
|
|
|