Structure of PDB 7mpu Chain B

Receptor sequence
>7mpuB (length=206) Species: 29459 (Brucella melitensis) [Search protein sequence]
SMTIRFHRNDLPNLDNYQVDAVAIDTETLGLNPHRDRLCVVQISPGDGTA
DVIQIEAGQKKAPNLVKLLKDRSITKIFHFGRFDLAVLAHAFGTMPQPVF
CTKIASKLTRTYTDRHGLKEICSELLDVSISKQQQSSDWAAEVLSQAQLE
YAASDVLYLHRLKAVLEQRLERDGRTKQAEACFKFLPTRSELDLMGWAES
DIFAHS
3D structure
PDB7mpu Structural characterization of NrnC identifies unifying features of dinucleotidases.
ChainB
Resolution1.72 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna B T25 E26 T27 G29 L30 H78 F82 K102 G116 Q134 W138 T26 E27 T28 G30 L31 H79 F83 K103 G117 Q135 W139
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Sun Nov 17 19:05:10 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '7mpu', asym_id = 'B', title = 'Structural characterization of NrnC identifies unifying features of dinucleotidases.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='7mpu', asym_id='B', title='Structural characterization of NrnC identifies unifying features of dinucleotidases.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0003676,0006139,0008408', uniprot = '', pdbid = '7mpu', asym_id = 'B'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003676,0006139,0008408', uniprot='', pdbid='7mpu', asym_id='B')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>