Structure of PDB 7mjp Chain B

Receptor sequence

>7mjpB (length=338) Species: 10116 (Rattus norvegicus) [Search protein sequence]

RLPKARFIAKSGACNLAHKNIREQGRFLQDIFTTLVDLKWRHTLVIFTMS
FLCSWLLFAIMWWLVAFAHGDIYAYMEKGITEKSGLESAVCVTNVRSFTS
AFLFSIEVQVTIGFGGRMMTEECPLAITVLILQNIVGLIINAVMLGCIFM
KTAQAHRRAETLIFSRHAVIAVRNGKLCFMFRVGDLRKSMIISASVRIQV
VKKTTTPEGEVVPIHQQDIPVDNPIESNNIFLVAPLIICHVIDKRSPLYD
ISATDLVNQDLEVIVILEGVVETTGITTQARTSYIAEEIQWGHRFVSIVT
EEEGVYSVDYSKFGNTVRVAAPRCSARELDEKPSILIQ

3D structure

PDB

7mjp Vascular K ATP channel structural dynamics reveal regulatory mechanism by Mg-nucleotides.

Chain

Resolution

4.2 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ATP	B	S194 R195 Y339 S340	S165 R166 Y310 S311

Gene Ontology

	Molecular Function
GO:0005242	inward rectifier potassium channel activity
GO:0005515	protein binding
GO:0005524	ATP binding
GO:0015272	ATP-activated inward rectifier potassium channel activity
GO:0017098	sulfonylurea receptor binding
GO:0019829	ATPase-coupled monoatomic cation transmembrane transporter activity
GO:0099508	voltage-gated monoatomic ion channel activity involved in regulation of presynaptic membrane potential
GO:1902282	voltage-gated potassium channel activity involved in ventricular cardiac muscle cell action potential repolarization

	Biological Process
GO:0001508	action potential
GO:0001568	blood vessel development
GO:0001666	response to hypoxia
GO:0001774	microglial cell activation
GO:0001822	kidney development
GO:0001944	vasculature development
GO:0002027	regulation of heart rate
GO:0002250	adaptive immune response
GO:0002931	response to ischemia
GO:0003007	heart morphogenesis
GO:0003229	ventricular cardiac muscle tissue development
GO:0006813	potassium ion transport
GO:0006915	apoptotic process
GO:0006950	response to stress
GO:0006954	inflammatory response
GO:0007507	heart development
GO:0008217	regulation of blood pressure
GO:0008283	cell population proliferation
GO:0008340	determination of adult lifespan
GO:0009306	protein secretion
GO:0009410	response to xenobiotic stimulus
GO:0010087	phloem or xylem histogenesis
GO:0010467	gene expression
GO:0015908	fatty acid transport
GO:0019226	transmission of nerve impulse
GO:0030010	establishment of cell polarity
GO:0032496	response to lipopolysaccharide
GO:0032868	response to insulin
GO:0033198	response to ATP
GO:0034097	response to cytokine
GO:0034220	monoatomic ion transmembrane transport
GO:0034765	regulation of monoatomic ion transmembrane transport
GO:0034976	response to endoplasmic reticulum stress
GO:0038066	p38MAPK cascade
GO:0042311	vasodilation
GO:0043330	response to exogenous dsRNA
GO:0044546	NLRP3 inflammasome complex assembly
GO:0045444	fat cell differentiation
GO:0048144	fibroblast proliferation
GO:0050877	nervous system process
GO:0050905	neuromuscular process
GO:0051124	synaptic assembly at neuromuscular junction
GO:0051607	defense response to virus
GO:0060920	cardiac pacemaker cell differentiation
GO:0060922	atrioventricular node cell differentiation
GO:0060976	coronary vasculature development
GO:0061535	glutamate secretion, neurotransmission
GO:0061762	CAMKK-AMPK signaling cascade
GO:0070588	calcium ion transmembrane transport
GO:0071805	potassium ion transmembrane transport
GO:0072359	circulatory system development
GO:0098662	inorganic cation transmembrane transport
GO:0098915	membrane repolarization during ventricular cardiac muscle cell action potential
GO:0099505	regulation of presynaptic membrane potential
GO:0150103	reactive gliosis
GO:1904638	response to resveratrol
GO:1990573	potassium ion import across plasma membrane

	Cellular Component
GO:0005886	plasma membrane
GO:0008282	inward rectifying potassium channel
GO:0016020	membrane
GO:0030016	myofibril
GO:0031004	potassium ion-transporting ATPase complex
GO:0032991	protein-containing complex
GO:0034702	monoatomic ion channel complex
GO:0042383	sarcolemma
GO:0048787	presynaptic active zone membrane
GO:0098793	presynapse
GO:0098978	glutamatergic synapse

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7mjp, PDBe:7mjp, PDBj:7mjp
PDBsum	7mjp
PubMed	34711681
UniProt	Q63664\|KCNJ8_RAT ATP-sensitive inward rectifier potassium channel 8 (Gene Name=Kcnj8)

[Back to BioLiP]