Structure of PDB 7mey Chain B

Receptor sequence

>7meyB (length=153) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]

TPARRRLMRDFKRMKEDAPPGVSASPLPDNVMVWNAMIIGPADTPYEDGT
FRLLLEFDEEYPNKPPHVKFLSEMFHPNVYANGEICLDILQNRWTPTYDV
ASILTSIQSLFNDPNPASPANVEAATLFKDHKSQYVKRVKETVEKSWEDD
MDD

3D structure

PDB

7mey Structural insights into Ubr1-mediated N-degron polyubiquitination.

Chain

Resolution

3.67 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

2.3.2.23: E2 ubiquitin-conjugating enzyme.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	Z3V	B	C88 S120 P121	C86 S118 P119

Gene Ontology

	Molecular Function
GO:0003697	single-stranded DNA binding
GO:0004842	ubiquitin-protein transferase activity
GO:0005515	protein binding
GO:0005524	ATP binding
GO:0016740	transferase activity
GO:0017116	single-stranded DNA helicase activity
GO:0061631	ubiquitin conjugating enzyme activity
GO:0070628	proteasome binding

	Biological Process
GO:0000209	protein polyubiquitination
GO:0000722	telomere maintenance via recombination
GO:0000724	double-strand break repair via homologous recombination
GO:0006281	DNA repair
GO:0006325	chromatin organization
GO:0006353	DNA-templated transcription termination
GO:0006366	transcription by RNA polymerase II
GO:0006511	ubiquitin-dependent protein catabolic process
GO:0009302	sno(s)RNA transcription
GO:0016567	protein ubiquitination
GO:0030435	sporulation resulting in formation of a cellular spore
GO:0031509	subtelomeric heterochromatin formation
GO:0031571	mitotic G1 DNA damage checkpoint signaling
GO:0032508	DNA duplex unwinding
GO:0034620	cellular response to unfolded protein
GO:0036503	ERAD pathway
GO:0042138	meiotic DNA double-strand break formation
GO:0042275	error-free postreplication DNA repair
GO:0042276	error-prone translesion synthesis
GO:0043161	proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0070987	error-free translesion synthesis
GO:0071596	ubiquitin-dependent protein catabolic process via the N-end rule pathway
GO:0071629	cytoplasm protein quality control by the ubiquitin-proteasome system
GO:0090089	regulation of dipeptide transport
GO:0120174	stress-induced homeostatically regulated protein degradation pathway

	Cellular Component
GO:0000781	chromosome, telomeric region
GO:0000785	chromatin
GO:0005634	nucleus
GO:0005737	cytoplasm
GO:0033503	HULC complex
GO:0097505	Rad6-Rad18 complex
GO:1990303	UBR1-RAD6 ubiquitin ligase complex
GO:1990304	MUB1-RAD6-UBR2 ubiquitin ligase complex
GO:1990305	RAD6-UBR2 ubiquitin ligase complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7mey, PDBe:7mey, PDBj:7mey
PDBsum	7mey
PubMed	34789879
UniProt	P06104\|UBC2_YEAST Ubiquitin-conjugating enzyme E2 2 (Gene Name=RAD6)

[Back to BioLiP]