Structure of PDB 7lms Chain B |
>7lmsB (length=138) Species: 103903 (Coxsackievirus B3 (strain Nancy)) [Search protein sequence] |
SGAVYVGNYRVVNRHLATSADWQNCVWESYNRDLLVSTTTAHGCDIIARC QCTTGVYFCASKNKHYPISFEGPGLVEVQESEYYPRRYQSHVLLAAGFSE PGDAGGILRCEHGVIGIVTMGGEGVVGFADIRDLLWLE |
|
PDB | 7lms Structure-function analysis of enterovirus protease 2A in complex with its essential host factor SETD3. |
Chain | B |
Resolution | 3.5 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
B |
C53 C55 C113 H115 |
C50 C52 C110 H112 |
|
|
|
|