Structure of PDB 7lj0 Chain B

Receptor sequence

>7lj0B (length=145) Species: 35688 (Porphyridium purpureum)

DGNKRLDAVNSIVSNASCMVSDAVSGMICENPGLISPGGNCYTNRRMAAC
LRDGEIILRYVSYALLAGDASVLEDRCLNGLKETYIALGVPTNSSIRAVS
IMKAQAVAFITNTATERKMSFAAGDCTSLASEVASYFDRVGAAIS

3D structure

• PDB: 7lj0 Scaffolding proteins guide the evolution of algal light harvesting antennas.
• Chain: B
• Resolution: 2.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	B	E87 I88 R91 Y92 Y95 R108	E55 I56 R59 Y60 Y63 R76
BS02	PEB	B	M59 N72 C73 R77 R78 A81 C82 R84 D85 I88 Y92 L120 V122 P123 S126 S127	M27 N40 C41 R45 R46 A49 C50 R52 D53 I56 Y60 L88 V90 P91 S94 S95
BS03	PEB	B	N35 K36 L38 D39 I142 F153 A154 A155 G156 C158	N3 K4 L6 D7 I110 F121 A122 A123 G124 C126
BS04	PEB	B	C50 D54 S57 G58 C61 R129 A136 Q137 F141 A146 T147 E148 R149	C18 D22 S25 G26 C29 R97 A104 Q105 F109 A114 T115 E116 R117

Gene Ontology

Biological Process

• GO:0015979 photosynthesis

Cellular Component

• GO:0009507 chloroplast
• GO:0009535 chloroplast thylakoid membrane
• GO:0009579 thylakoid
• GO:0016020 membrane
• GO:0030089 phycobilisome

External links

• PDB: RCSB:7lj0, PDBe:7lj0, PDBj:7lj0
• PDBsum: 7lj0
• PubMed: 33767155
• UniProt: P11393|PHEB_PORPP B-phycoerythrin beta chain (Gene Name=cpeB)