Structure of PDB 7lix Chain B

Receptor sequence

>7lixB (length=162) Species: 35688 (Porphyridium purpureum)

AAYVGGSDLQALKSFIADGNKRLDAVNSIVSNASCMVSDAVSGMICENPG
LISPGGNCYTNRRMAACLRDGEIILRYVSYALLAGDASVLEDRCLNGLKE
TYIALGVPTNSSIRAVSIMKAQAVAFITNTATERKMSFAAGDCTSLASEV
ASYFDRVGAAIS

3D structure

• PDB: 7lix Scaffolding proteins guide the evolution of algal light harvesting antennas.
• Chain: B
• Resolution: 2.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	PEB	B	M59 N72 C73 R77 R78 C82 R84 D85 L120 V122 P123	M44 N57 C58 R62 R63 C67 R69 D70 L105 V107 P108
BS02	PEB	B	K28 N35 K36 L38 D39 I142 F153 A154 G156 C158	K13 N20 K21 L23 D24 I127 F138 A139 G141 C143
BS03	PEB	B	C50 D54 G58 C61 A136 Q137 F141 E148	C35 D39 G43 C46 A121 Q122 F126 E133

Gene Ontology

Biological Process

• GO:0015979 photosynthesis

Cellular Component

• GO:0009507 chloroplast
• GO:0009535 chloroplast thylakoid membrane
• GO:0009579 thylakoid
• GO:0016020 membrane
• GO:0030089 phycobilisome

External links

• PDB: RCSB:7lix, PDBe:7lix, PDBj:7lix
• PDBsum: 7lix
• PubMed: 33767155
• UniProt: P11393|PHEB_PORPP B-phycoerythrin beta chain (Gene Name=cpeB)