Structure of PDB 7l76 Chain B |
>7l76B (length=188) Species: 83333 (Escherichia coli K-12) [Search protein sequence] |
AQYEDGKQYTTLEKPVAGAPQVLEFFSFFCPHCYQFEEVLHISDNVKKKL PEGVKMTKYHVNFMGGDLGKDLTQAWAVAMALGVEDKVTVPLFEGVQKTQ TIRSASDIRDVFINAGIKGEEYDAAWNSFVVKSLVAQQEKAAADVQLRGV PAMFVNGKYQLNPQGMDTSNMDVFVQQYADTVKYLSEK |
|
PDB | 7l76 Elaboration of a benzofuran scaffold and evaluation of binding affinity and inhibition of Escherichia coli DsbA: A fragment-based drug design approach to novel antivirulence compounds. |
Chain | B |
Resolution | 1.83 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CU |
B |
A1 E4 |
A1 E4 |
|
|
|
|