Structure of PDB 7kld Chain B

Receptor sequence
>7kldB (length=106) Species: 1280 (Staphylococcus aureus) [Search protein sequence]
MITVDITVNDEGKVTDVIMDGHADHGEYGHDIVCAGASAVLFGSVNAIIG
LTSERPDINYDDNGGHFHIRSVDTNNDEAQLILQTMLVSLQTIEEEYNEN
IRLNYK
3D structure
PDB7kld Phage-Related Ribosomal Protease (Prp) of Staphylococcus aureus : In Vitro Michaelis-Menten Kinetics, Screening for Inhibitors, and Crystal Structure of a Covalent Inhibition Product Complex.
ChainB
Resolution2.25 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 3.4.22.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide B I2 H22 A23 G29 D31 C34 A35 S38 A39 F42 G65 I2 H22 A23 G29 D31 C34 A35 S38 A39 F42 G65
BS02 peptide B I32 T92 Y97 I32 T92 Y97
BS03 CA B L51 E78 L51 E78
BS04 CA B D57 N59 D57 N59
Gene Ontology
Molecular Function
GO:0008234 cysteine-type peptidase activity
Biological Process
GO:0006508 proteolysis
GO:0042254 ribosome biogenesis

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7kld, PDBe:7kld, PDBj:7kld
PDBsum7kld
PubMed35731716
UniProtQ2FXS9|PRP_STAA8 Ribosomal processing cysteine protease Prp (Gene Name=prp)

[Back to BioLiP]