Structure of PDB 7kiu Chain B

Receptor sequence

>7kiuB (length=263) Species: 9606 (Homo sapiens)

PMRICSFNVRSFGESKQEDKNAMDVIVKVIKRCDIILVMEIKDSNNRICP
ILMEKLNRNSRRGITYNYVISSRLGRNTYKEQYAFLYKEKLVSVKRSYHY
HDYQDGDADVFSREPFVVWFQSPHTAVKDFVIIPLHTTPETSVKEIDELV
EVYTDVKHRWKAENFIFMGDFNAGCSYVPKKAWKNIRLRTDPRFVWLIGD
QEDTTVKKSTNCAYDRIVLRGQEIVSSVVPKSNSVFDFQKAYKLTEEEAL
DVSDHFPVEFKLQ

3D structure

• PDB: 7kiu Structural features of Dnase1L3 responsible for serum antigen clearance.
• Chain: B
• Resolution: 2.22 Å

Enzymatic activity

• Enzyme Commision number: 3.1.21.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MG	B	D222 T224 K226 T229	D203 T205 K207 T210
BS02	MG	B	E59 D273	E40 D254

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0003824 catalytic activity
• GO:0004519 endonuclease activity
• GO:0004520 DNA endonuclease activity
• GO:0004530 deoxyribonuclease I activity
• GO:0004536 DNA nuclease activity
• GO:0005509 calcium ion binding
• GO:0005515 protein binding

Biological Process

• GO:0002283 neutrophil activation involved in immune response
• GO:0002673 regulation of acute inflammatory response
• GO:0006259 DNA metabolic process
• GO:0006308 DNA catabolic process
• GO:0006309 apoptotic DNA fragmentation
• GO:0006915 apoptotic process
• GO:0010623 programmed cell death involved in cell development
• GO:0070948 regulation of neutrophil mediated cytotoxicity

Cellular Component

• GO:0005576 extracellular region
• GO:0005634 nucleus
• GO:0005783 endoplasmic reticulum

External links

• PDB: RCSB:7kiu, PDBe:7kiu, PDBj:7kiu
• PDBsum: 7kiu
• PubMed: 35974043
• UniProt: Q13609|DNSL3_HUMAN Deoxyribonuclease gamma (Gene Name=DNASE1L3)