Structure of PDB 7kd6 Chain B

Receptor sequence
>7kd6B (length=49) Species: 9606 (Homo sapiens) [Search protein sequence]
FVNQHLCGSHLVEALYLVCGERGFFPRRGIVEQCCHSICSLEQLENYCN
3D structure
PDB7kd6 Single-chain insulin analogs threaded by the insulin receptor alpha CT domain.
ChainB
Resolution2.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide B G8 V12 F24 F25 R35 G37 I38 V39 E40 E53 N54 Y55 C56 G8 V12 F24 F25 R27 G29 I30 V31 E32 E45 N46 Y47 C48
Gene Ontology
Molecular Function
GO:0005179 hormone activity
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:7kd6, PDBe:7kd6, PDBj:7kd6
PDBsum7kd6
PubMed36181268
UniProtP01308|INS_HUMAN Insulin (Gene Name=INS)

[Back to BioLiP]