Structure of PDB 7jz2 Chain B

Receptor sequence

>7jz2B (length=238) Species: 83333 (Escherichia coli K-12)

MRLEFSIYRYNPDVDDAPRMQDYTLEADEGRDMMLLDALIQLKEKDPSLS
FRRSCREGVCGSDGLNMNGKNGLACITPISALNQPGKKIVIRPLPGLPVI
RDLVVDMGQFYAQYEKIKPYLLNNGQNPPAREHLQMPEQREKLDGLYECI
LCACCSTSCPSFWWNPDKFIGPAGLLAAYRFLIDSRDTETDSRLDGLSDA
FSVFRCHSIMNCVSVCPKGLNPTRAIGHIKSMLLQRNA

3D structure

• PDB: 7jz2 A 'Build and Retrieve' methodology to simultaneously solve cryo-EM structures of membrane proteins.
• Chain: B
• Resolution: 2.5 Å

Enzymatic activity

• Enzyme Commision number: 1.3.5.1: succinate dehydrogenase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FES	B	R53 S54 C55 R56 G58 C60 G61 S62 D63 C75	R53 S54 C55 R56 G58 C60 G61 S62 D63 C75
BS02	SF4	B	C149 I150 C152 C155 C216 P217 L220	C149 I150 C152 C155 C216 P217 L220
BS03	F3S	B	C159 P172 C206 H207 S208 I209 M210 C212 T223 I226	C159 P172 C206 H207 S208 I209 M210 C212 T223 I226

Gene Ontology

Molecular Function

• GO:0005515 protein binding
• GO:0008177 succinate dehydrogenase (quinone) activity
• GO:0009055 electron transfer activity
• GO:0016491 oxidoreductase activity
• GO:0046872 metal ion binding
• GO:0051536 iron-sulfur cluster binding
• GO:0051537 2 iron, 2 sulfur cluster binding
• GO:0051538 3 iron, 4 sulfur cluster binding
• GO:0051539 4 iron, 4 sulfur cluster binding

Biological Process

• GO:0006099 tricarboxylic acid cycle
• GO:0009060 aerobic respiration
• GO:0019646 aerobic electron transport chain
• GO:0022904 respiratory electron transport chain

Cellular Component

• GO:0005886 plasma membrane
• GO:0016020 membrane

External links

• PDB: RCSB:7jz2, PDBe:7jz2, PDBj:7jz2
• PDBsum: 7jz2
• PubMed: 33408407
• UniProt: P07014|SDHB_ECOLI Succinate dehydrogenase iron-sulfur subunit (Gene Name=sdhB)