Structure of PDB 7jxq Chain B

Receptor sequence

>7jxqB (length=297) Species: 9606 (Homo sapiens)

QALLRILKETEFKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELREA
TSPKANKEILDEAYVMASVDNPHVCRLLGICLTSTVQLIMQLMPFGCLLD
YVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQH
VKITDFGLAKLLGAKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTF
GSKPYDGIPASEISSILEKGERLPQPPICTIDVYMIMRKCWMIDADSRPK
FRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRALMDEEDM

3D structure

• PDB: 7jxq An allosteric inhibitor against the therapy-resistant mutant forms of EGFR in non-small cell lung cancer.
• Chain: B
• Resolution: 1.83 Å

Enzymatic activity

• Enzyme Commision number: 2.7.10.1: receptor protein-tyrosine kinase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MG	B	N842 D855	N142 D155
BS02	ANP	B	G719 G721 A722 V726 A743 K745 M790 M793 C797 D837 R841 N842 L844 D855	G19 G21 A22 V26 A43 K45 M90 M93 C97 D137 R141 N142 L144 D155
BS03	VNS	B	V726 A743 K745 E749 E758 I759 M766 R776 L777 L788 M790 D855 F856 L858 L861	V26 A43 K45 E49 E58 I59 M66 R76 L77 L88 M90 D155 F156 L158 L161

Gene Ontology

Molecular Function

• GO:0004672 protein kinase activity
• GO:0004713 protein tyrosine kinase activity
• GO:0005524 ATP binding

Biological Process

• GO:0006468 protein phosphorylation

External links

• PDB: RCSB:7jxq, PDBe:7jxq, PDBj:7jxq
• PDBsum: 7jxq
• PubMed: 35422503
• UniProt: P00533|EGFR_HUMAN Epidermal growth factor receptor (Gene Name=EGFR)