Structure of PDB 7jtz Chain B

Receptor sequence

>7jtzB (length=143) Species: 559292 (Saccharomyces cerevisiae S288C)

DEGETFATEQTTQQVFQKLGSNMENRVCFDCGNKNPTWTSVPFGVMLCIQ
CSAVHRNMGVHITFVKSSTLDKWTINNLRRFKLGGNHKARDFFLKNNGKQ
LLNTANVDAKTKYTSPVAKKYKIHLDKKVQKDMELYPSELVLN

3D structure

• PDB: 7jtz The Glo3 GAP crystal structure supports the molecular niche model for ArfGAPs in COPI coats.
• Chain: B
• Resolution: 2.07 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	B	C31 C34 C54	C28 C31 C51

Gene Ontology

Molecular Function

• GO:0005096 GTPase activator activity

External links

• PDB: RCSB:7jtz, PDBe:7jtz, PDBj:7jtz
• PDBsum: 7jtz
• PubMed: 33436318
• UniProt: P38682|GLO3_YEAST ADP-ribosylation factor GTPase-activating protein GLO3 (Gene Name=GLO3)