Structure of PDB 7ins Chain B

Receptor sequence

>7insB (length=30) Species: 9823 (Sus scrofa)

FVNQHLCGSHLVEALYLVCGERGFFYTPKA

3D structure

• PDB: 7ins Structure of porcine insulin cocrystallized with clupeine Z.
• Chain: B
• Resolution: 2.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	B	C7 L11 V18 C19 R22 G23 F24 Y26 K29 A30	C7 L11 V18 C19 R22 G23 F24 Y26 K29 A30
BS02	peptide	B	F1 V2	F1 V2
BS03	peptide	B	V2 N3 Q4 H5 L6 S9 H10 E13 Y16 L17 G20 T27 K29 A30	V2 N3 Q4 H5 L6 S9 H10 E13 Y16 L17 G20 T27 K29 A30

Gene Ontology

Molecular Function

• GO:0005179 hormone activity

Cellular Component

• GO:0005576 extracellular region

External links

• PDB: RCSB:7ins, PDBe:7ins, PDBj:7ins
• PDBsum: 7ins
• PubMed: 1772633
• UniProt: P01315|INS_PIG Insulin (Gene Name=INS)