Structure of PDB 7fqk Chain B

Receptor sequence
>7fqkB (length=261) Species: 9606 (Homo sapiens) [Search protein sequence]
GGKHWVVIVAGSNGWYNYRHQADACHAYQIIHRNGIPDEQIVVMMYDDIA
YSEDNPTPGIVINRPNGTDVYQGVPKDYTGEDVTPQNFLAVLRGDAEAVK
GIGSGKVLKSGPQDHVFIYFTcHGSTGILVFPNEDLHVKDLNETIHYMYK
HKMYRKMVFYIEACESGSMMNHLPDNINVYATTAANPRESSYACYYDEKR
STYLGDWYSVNWMEDSDVEDLTKETLHKQYHLVKSHTNTSHVMQYGQKTI
STMKVMQFQGM
3D structure
PDB7fqk Crystal Structure of a human Legumain complex
ChainB
Resolution1.97 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 3.4.22.34: legumain.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 WS9 B Y41 R44 H45 H148 G149 C189 S216 Y217 A218 D231 Y16 R19 H20 H123 G124 C164 S191 Y192 A193 D206
Gene Ontology
Molecular Function
GO:0004175 endopeptidase activity
GO:0004197 cysteine-type endopeptidase activity
GO:0008233 peptidase activity
GO:0008234 cysteine-type peptidase activity
GO:0048156 tau protein binding
GO:0061133 endopeptidase activator activity
Biological Process
GO:0003014 renal system process
GO:0006508 proteolysis
GO:0006624 vacuolar protein processing
GO:0007613 memory
GO:0008284 positive regulation of cell population proliferation
GO:0008306 associative learning
GO:0010447 response to acidic pH
GO:0010629 negative regulation of gene expression
GO:0019886 antigen processing and presentation of exogenous peptide antigen via MHC class II
GO:0032801 receptor catabolic process
GO:0035729 cellular response to hepatocyte growth factor stimulus
GO:0040015 negative regulation of multicellular organism growth
GO:0042359 vitamin D metabolic process
GO:0043524 negative regulation of neuron apoptotic process
GO:0045931 positive regulation of mitotic cell cycle
GO:0051603 proteolysis involved in protein catabolic process
GO:0051604 protein maturation
GO:0071277 cellular response to calcium ion
GO:0090026 positive regulation of monocyte chemotaxis
GO:0097061 dendritic spine organization
GO:0097202 activation of cysteine-type endopeptidase activity
GO:0097264 self proteolysis
GO:1900273 positive regulation of long-term synaptic potentiation
GO:1901185 negative regulation of ERBB signaling pathway
GO:1904646 cellular response to amyloid-beta
GO:2001028 positive regulation of endothelial cell chemotaxis
Cellular Component
GO:0005576 extracellular region
GO:0005737 cytoplasm
GO:0005764 lysosome
GO:0005770 late endosome
GO:0036021 endolysosome lumen
GO:0043202 lysosomal lumen
GO:0045177 apical part of cell
GO:0048471 perinuclear region of cytoplasm
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7fqk, PDBe:7fqk, PDBj:7fqk
PDBsum7fqk
PubMed
UniProtQ99538|LGMN_HUMAN Legumain (Gene Name=LGMN)

[Back to BioLiP]