Structure of PDB 7ff9 Chain B

Receptor sequence
>7ff9B (length=195) Species: 208964 (Pseudomonas aeruginosa PAO1) [Search protein sequence]
LDKLLAHCHRRRYTAKSTIIYAGDRCETLFFIIKGSVTILIEDDDGREMI
IGYLNSGDFFGELGLFEKEQERSAWVRAKVECEVAEISYAKFRELSQQDS
EILYTLGSQMADRLRKTTRKVGDLAFLDVTGRVARTLLDLCQQPDAMTHP
DGMQIKITRQEIGRIVGCSREMVGRVLKSLEEQGLVHVKTMVVFG
3D structure
PDB7ff9 Inhibitory mechanism of gold analogues against Pseudomonas global virulence factor regulator Vfr
ChainB
Resolution2.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CMP B I51 I63 F72 G73 E74 L75 R87 S88 V91 R128 T132 I39 I51 F60 G61 E62 L63 R72 S73 V76 R113 T117
Gene Ontology
Molecular Function
GO:0000976 transcription cis-regulatory region binding
GO:0001216 DNA-binding transcription activator activity
GO:0001217 DNA-binding transcription repressor activity
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0030552 cAMP binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006351 DNA-templated transcription
GO:0006355 regulation of DNA-templated transcription
GO:0045892 negative regulation of DNA-templated transcription
GO:0045893 positive regulation of DNA-templated transcription
Cellular Component
GO:0005829 cytosol
GO:0032993 protein-DNA complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7ff9, PDBe:7ff9, PDBj:7ff9
PDBsum7ff9
PubMed
UniProtP55222|VFR_PSEAE cAMP-activated global transcriptional regulator Vfr (Gene Name=vfr)

[Back to BioLiP]