Structure of PDB 7f2r Chain B |
>7f2rB (length=79) Species: 1944 (Streptomyces halstedii) [Search protein sequence] |
MWDAQFENLLRRYLPFLSADQPLEQDINLRDIGLDSLGTVELLSELENTY DVHFQDEALTKETFETPGVLWKTLSQMVE |
|
PDB | 7f2r Complex structure of the acyltransferase VinK and the carrier protein VinL with a pantetheine cross-linking probe. |
Chain | B |
Resolution | 1.95 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
9EF |
B |
R30 D35 S36 |
R30 D35 S36 |
|
|
|