Structure of PDB 7f0l Chain B

Receptor sequence
>7f0lB (length=44) Species: 1063 (Cereibacter sphaeroides) [Search protein sequence]
DLGYTGLTDEQAQELHSVYMSGLWLFSAVAIVAHLAVYIWRPWF
3D structure
PDB7f0l A previously unrecognized membrane protein in the Rhodobacter sphaeroides LH1-RC photocomplex.
ChainB
Resolution2.94 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 BCL B L29 V33 A34 A37 H38 L25 V29 A30 A33 H34
BS02 BCL B F30 S31 A34 I35 H38 W47 F48 F26 S27 A30 I31 H34 W43 F44
BS03 BCL B Y23 F48 Y19 F44
BS04 SPO B G26 L27 G22 L23
Gene Ontology
Molecular Function
GO:0042314 bacteriochlorophyll binding
GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872 metal ion binding
Biological Process
GO:0019684 photosynthesis, light reaction
Cellular Component
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0030076 light-harvesting complex
GO:0030077 plasma membrane light-harvesting complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7f0l, PDBe:7f0l, PDBj:7f0l
PDBsum7f0l
PubMed34728609
UniProtQ3J1A3|LHB1_CERS4 Light-harvesting protein B-875 beta chain (Gene Name=pufB)

[Back to BioLiP]