Structure of PDB 7exk Chain B

Receptor sequence

>7exkB (length=217) Species: 914234 (Gelatoporia subvermispora B)

HYTLPDLIANGTVAADWQFVRETANHYTNGPVTDVTDEAIRCYELDYSAT
PGETNIATVSAGSTVGMQGNGAFYHPGYFSAYLSQASPAANSPDAGTAST
WFKIWEDPPVFENGALVFPSQSIDQVTFTIPKNLPSGQYLLRTEQIALHV
ASTFGGAQFYIGCAQLNVVDGGSGTPGPTVAFPGAYTGNEPGILINIYDL
PAGYTGYQSPGPAVWQG

3D structure

• PDB: 7exk Functional and Structural Characterizations of Lytic Polysaccharide Monooxygenase, Which Cooperates Synergistically with Cellulases, from Ceriporiopsis subvermispora.
• Chain: B
• Resolution: 2.14 Å

Enzymatic activity

• Enzyme Commision number: 3.2.1.4: cellulase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CU	B	H1 H75	H1 H75

Gene Ontology

Molecular Function

• GO:0008810 cellulase activity
• GO:0016798 hydrolase activity, acting on glycosyl bonds
• GO:0030248 cellulose binding
• GO:0046872 metal ion binding

Biological Process

• GO:0030245 cellulose catabolic process

Cellular Component

• GO:0005576 extracellular region

External links

• PDB: RCSB:7exk, PDBe:7exk, PDBj:7exk
• PDBsum: 7exk
• UniProt: M2RAI8