Structure of PDB 7exc Chain B

Receptor sequence

>7excB (length=427) Species: 9823 (Sus scrofa)

REIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYY
NEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNW
AKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLL
ISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYC
IDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLR
KLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMA
ACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKT
AVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGE
GMDEMEFTEAESNMNDLVSEYQQYQDA

3D structure

• PDB: 7exc Structure-Based Design and Synthesis of N-Substituted 3-Amino-beta-Carboline Derivatives as Potent alpha beta-Tubulin Degradation Agents
• Chain: B
• Resolution: 2.39 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MG	B	Q11 N99 D177	Q10 N98 D176
BS02	JEL	B	F20 Q134 T136 T166 F167 E198 Y200 M233 L240 L250 L253 M257 A314 V316	F19 Q133 T135 T165 F166 E197 Y199 M232 L239 L249 L252 M256 A313 V315
BS03	GDP	B	G10 Q11 C12 Q15 S138 G141 G142 T143 G144 E181 N204 Y222 N226	G9 Q10 C11 Q14 S137 G140 G141 T142 G143 E180 N203 Y221 N225

Gene Ontology

Molecular Function

• GO:0003924 GTPase activity
• GO:0005200 structural constituent of cytoskeleton
• GO:0005515 protein binding
• GO:0005525 GTP binding
• GO:0046872 metal ion binding

Biological Process

• GO:0000226 microtubule cytoskeleton organization
• GO:0000278 mitotic cell cycle
• GO:0007017 microtubule-based process

Cellular Component

• GO:0005737 cytoplasm
• GO:0005856 cytoskeleton
• GO:0005874 microtubule

External links

• PDB: RCSB:7exc, PDBe:7exc, PDBj:7exc
• PDBsum: 7exc
• UniProt: P02554|TBB_PIG Tubulin beta chain