Structure of PDB 7eun Chain B

Receptor sequence

>7eunB (length=274) Species: 1914 (Streptomyces lavendulae)

MIDLIVSQGRVADRAAWMIEGAARTARALEERYGLKGHYVGEPAPHADDD
WSVALPQARETLVAVREAATESIKGDNLTVLVNNTCSVSLATLPVVAREH
PDAVVLYIDGHGDFNTPETTDTGYLGGMVLSGACGLWDSGHGAGLRPEQA
VLVGSRDIDEGERELIRKAGVRVIPPGEATAQAVLDAVKDAPVWIHIDWD
VLEPGSIPADYTVPDGMLPAQIRAVFEAIPAERLIGVELAELNAPADSER
AEQAVAVILDMVAPAFDAAAARPL

3D structure

• PDB: 7eun Catalytic mechanism of DcsB: Arginase framework used for hydrolyzing its inhibitor.
• Chain: B
• Resolution: 1.28 Å

Enzymatic activity

• Enzyme Commision number: 3.5.3.25: N(omega)-hydroxy-L-arginine amidinohydrolase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MN	B	C86 D109 D113 D198	C86 D109 D113 D198
BS02	MN	B	D109 H111 D198 D200	D109 H111 D198 D200
BS03	MG	B	D198 D200 D210 E241	D198 D200 D210 E241
BS04	MG	B	Q57 A58 E60 T61	Q57 A58 E60 T61
BS05	ABH	B	C86 D109 H111 D113 T122 G126 D159 D198 D210 Y211 E241	C86 D109 H111 D113 T122 G126 D159 D198 D210 Y211 E241

Gene Ontology

Molecular Function

• GO:0004053 arginase activity
• GO:0016787 hydrolase activity
• GO:0016813 hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amidines
• GO:0030145 manganese ion binding
• GO:0046872 metal ion binding

Biological Process

• GO:0017000 antibiotic biosynthetic process
• GO:0019547 arginine catabolic process to ornithine

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:7eun, PDBe:7eun, PDBj:7eun
• PDBsum: 7eun
• PubMed: 35634777
• UniProt: D2Z025|DCSB_STRLA N(omega)-hydroxy-L-arginine amidinohydrolase (Gene Name=dcsB)