Structure of PDB 7eu6 Chain B

Receptor sequence

>7eu6B (length=111) Species: 1888 (Streptomyces albus)

AEIVTALPVPLAVPAPFYLTADMFGGLPVQLAGGELSKLVKPVAAPHVHE
VDELYFLVSPEPGQARIEVHLDGVRHELVSPAVMRIPAGSEHCFLTLEAT
VGSYCFGILVG

3D structure

• PDB: 7eu6 Structural and Mechanistic Bases for StnK3 and Its Mutant-Mediated Lewis-Acid-Dependent Epimerization and Retro-Aldol Reactions.
• Chain: B
• Resolution: 2.05011 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FE	B	H64 H66 E70 H109	H47 H49 E53 H92

Gene Ontology

Molecular Function

• GO:0046872 metal ion binding

External links

• PDB: RCSB:7eu6, PDBe:7eu6, PDBj:7eu6
• PDBsum: 7eu6
• UniProt: L7PIL3