Structure of PDB 7elc Chain B

Receptor sequence
>7elcB (length=49) [Search protein sequence]
LYGRYNCKCCWFADTNLITCNDHYLCLRCHQTMLRNSELCHICWKPLPT
3D structure
PDB7elc Cryo-EM structures of Lassa and Machupo virus polymerases complexed with cognate regulatory Z proteins identify targets for antivirals.
ChainB
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ZN B C39 C42 C58 C61 C7 C10 C26 C29
BS02 ZN B C52 H55 C72 C75 C20 H23 C40 C43
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0008270 zinc ion binding
GO:0046872 metal ion binding
Biological Process
GO:0039702 viral budding via host ESCRT complex
GO:0046761 viral budding from plasma membrane
Cellular Component
GO:0016020 membrane
GO:0020002 host cell plasma membrane
GO:0030430 host cell cytoplasm
GO:0044220 host cell perinuclear region of cytoplasm
GO:0044423 virion component

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7elc, PDBe:7elc, PDBj:7elc
PDBsum7elc
PubMed34127846
UniProtQ6UY77

[Back to BioLiP]