Structure of PDB 7ej7 Chain B

Receptor sequence
>7ej7B (length=316) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
ILSVDELQNYGINASDLQKLKSGGIYTVNTVLSTTRRHLCKIKGLSEVKV
EKIKEAAGKIIQVGFIPATVQLDIRQRVYSLSTGSKQLDSILGGGIMTMS
ITEVFGEFRCGKTQMSHTLCVTTQLPREMGGGEGKVAYIDTEGTFRPERI
KQIAEGYELDPESCLANVSYARALNSEHQMELVEQLGEELSSGDYRLIVV
DSIMANFRVDYCGRGELSERQQKLNQHLFKLNRLAEEFNVAVFLTNQVQS
DPGASALFASADGRKPIGGHVLAHASATRILLRKGRGDERVAKLQDSPDM
PEKECVYVIGEKGITD
3D structure
PDB7ej7 Mechanisms of distinctive mismatch tolerance between Rad51 and Dmc1 in homologous recombination.
ChainB
Resolution3.41 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna B S233 Q236 Q264 S265 P267 K280 G283 G284 H285 S218 Q221 Q249 S250 P252 K265 G268 G269 H270
BS02 dna B R229 G230 P267 R214 G215 P252
BS03 ATP B S312 P313 D314 M315 P316 S297 P298 D299 M300 P301
BS04 ATP B G126 K127 T128 Q129 R164 I324 G111 K112 T113 Q114 R149 I309
Gene Ontology
Molecular Function
GO:0000150 DNA strand exchange activity
GO:0000166 nucleotide binding
GO:0003677 DNA binding
GO:0003690 double-stranded DNA binding
GO:0003697 single-stranded DNA binding
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0008094 ATP-dependent activity, acting on DNA
GO:0016887 ATP hydrolysis activity
GO:0042030 ATPase inhibitor activity
GO:0140664 ATP-dependent DNA damage sensor activity
Biological Process
GO:0000709 meiotic joint molecule formation
GO:0000730 DNA recombinase assembly
GO:0006259 DNA metabolic process
GO:0006281 DNA repair
GO:0006312 mitotic recombination
GO:0007130 synaptonemal complex assembly
GO:0007131 reciprocal meiotic recombination
GO:0030435 sporulation resulting in formation of a cellular spore
GO:0042148 DNA strand invasion
GO:0051321 meiotic cell cycle
GO:0070192 chromosome organization involved in meiotic cell cycle
Cellular Component
GO:0000794 condensed nuclear chromosome
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7ej7, PDBe:7ej7, PDBj:7ej7
PDBsum7ej7
PubMed34871438
UniProtP25453|DMC1_YEAST Meiotic recombination protein DMC1 (Gene Name=DMC1)

[Back to BioLiP]