Structure of PDB 7ej6 Chain B

Receptor sequence

>7ej6B (length=316) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

ILSVDELQNYGINASDLQKLKSGGIYTVNTVLSTTRRHLCKIKGLSEVKV
EKIKEAAGKIIQVGFIPATVQLDIRQRVYSLSTGSKQLDSILGGGIMTMS
ITEVFGEFRCGKTQMSHTLCVTTQLPREMGGGEGKVAYIDTEGTFRPERI
KQIAEGYELDPESCLANVSYARALNSEHQMELVEQLGEELSSGDYRLIVV
DSIMANFRVDYCGRGELSERQQKLNQHLFKLNRLAEEFNVAVFLTNQVQS
DPGASALFASADGRKPIGGHVLAHASATRILLRKGRGDERVAKLQDSPDM
PEKECVYVIGEKGITD

3D structure

PDB

7ej6 Mechanisms of distinctive mismatch tolerance between Rad51 and Dmc1 in homologous recombination.

Chain

Resolution

3.21 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	dna	B	R223 L232 S233 R235 Q236 Q264 S265 P267 K280 G284 H285 V286	R208 L217 S218 R220 Q221 Q249 S250 P252 K265 G269 H270 V271
BS02	MG	B	T128 E157	T113 E142
BS03	ATP	B	H289 S312 P313 D314 M315 P316	H274 S297 P298 D299 M300 P301
BS04	ATP	B	F123 R124 G126 K127 T128 Q129 R164 I324 G325	F108 R109 G111 K112 T113 Q114 R149 I309 G310

Gene Ontology

	Molecular Function
GO:0000150	DNA strand exchange activity
GO:0000166	nucleotide binding
GO:0003677	DNA binding
GO:0003690	double-stranded DNA binding
GO:0003697	single-stranded DNA binding
GO:0005515	protein binding
GO:0005524	ATP binding
GO:0008094	ATP-dependent activity, acting on DNA
GO:0016887	ATP hydrolysis activity
GO:0042030	ATPase inhibitor activity
GO:0140664	ATP-dependent DNA damage sensor activity

	Biological Process
GO:0000709	meiotic joint molecule formation
GO:0000730	DNA recombinase assembly
GO:0006259	DNA metabolic process
GO:0006281	DNA repair
GO:0006312	mitotic recombination
GO:0007130	synaptonemal complex assembly
GO:0007131	reciprocal meiotic recombination
GO:0030435	sporulation resulting in formation of a cellular spore
GO:0042148	DNA strand invasion
GO:0051321	meiotic cell cycle
GO:0070192	chromosome organization involved in meiotic cell cycle

	Cellular Component
GO:0000794	condensed nuclear chromosome
GO:0005634	nucleus

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7ej6, PDBe:7ej6, PDBj:7ej6
PDBsum	7ej6
PubMed	34871438
UniProt	P25453\|DMC1_YEAST Meiotic recombination protein DMC1 (Gene Name=DMC1)

[Back to BioLiP]