Structure of PDB 7ehe Chain B

Receptor sequence

>7eheB (length=581) Species: 5544 (Trichoderma harzianum)

MDESFIGKSGGEIFHEMMLRQGVKHIFGYPGGAILPVFDAIYNSKHFDFI
LPRHEQGAGHMAEGYARASGKPGVVVVTSGPGATNVITPMQDALSDGTPM
VVFCGQVPTAAIADVVGISRACTKWNVMVKSVAELPRRINEAFEIATSGR
PGPVLVDLPKDVTAGILRRAIPELSTQQLNASIKRAADLINMGKKPVIYA
GQGVIQSEGGPELLKELADKASIPVTTTLHGLGAFDELDEKSLHMLGMHG
AAYANMAMQQADVIIALGSRFDDRVTGVVSKFAPAARQAAAEGRGGIIHF
EIMPKNINKVVQATEAVEGDVGANMKLLIPQVKAKTMEDRKEWFDAIKGW
KKKYPLSHYQRTGLIKPQTVMEEISNLTADRKDKTYIATGVGQHQMWVAQ
HFRWRHPRSMITSGGLGTMGYGLPAAIGAKVAQPDALVIDVDGDASFNMT
LTELSTAAQFNIGVKVVVLNNEEQGMVTQWQNLFYEDRYSHTHQRNPDFM
KLADAMGIQHQRVAEPDKLVDALKWLINTDGPALLEVVTDKKVPVLPMVP
AGSALHEFLVFDPEKDKQRRELMKERTKGVH

3D structure

• PDB: 7ehe Harzianic Acid from Trichoderma afroharzianum Is a Natural Product Inhibitor of Acetohydroxyacid Synthase.
• Chain: B
• Resolution: 2.28 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	TZD	B	P110 E135 P161	P30 E55 P81
BS02	MG	B	D551 N578 E580	D444 N471 E473
BS03	FAD	B	R237 G305 Q306 G307 Q310 S311 T332 L333 H334 L350 M352 H353 G372 S373 R374 D376 R378 V379 E405 I406 D424 V425 M503 G521	R150 G201 Q202 G203 Q206 S207 T228 L229 H230 L246 M248 H249 G268 S269 R270 D272 R274 V275 E301 I302 D320 V321 M396 G414
BS04	TZD	B	Q500 H501 G524 M526 G550 D551 A552 S553 E580 Q581 G582 M583 V584	Q393 H394 G417 M419 G443 D444 A445 S446 E473 Q474 G475 M476 V477

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sat Nov 23 08:36:20 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '7ehe', asym_id = 'B', title = 'Harzianic Acid from Trichoderma afroharzianum Is...l Product Inhibitor of Acetohydroxyacid Synthase.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='7ehe', asym_id='B', title='Harzianic Acid from Trichoderma afroharzianum Is...l Product Inhibitor of Acetohydroxyacid Synthase.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0000287,0003824,0003984,0009082,0030976,0050660', uniprot = '', pdbid = '7ehe', asym_id = 'B'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0000287,0003824,0003984,0009082,0030976,0050660', uniprot='', pdbid='7ehe', asym_id='B')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>