Structure of PDB 7ed5 Chain B |
>7ed5B (length=150) Species: 2697049 (Severe acute respiratory syndrome coronavirus 2) [Search protein sequence] |
NVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLF TMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVIPDYNTYKNTC DGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRAN |
|
PDB | 7ed5 A dual mechanism of action of AT-527 against SARS-CoV-2 polymerase. |
Chain | B |
Resolution | 2.98 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
B |
N43 K46 |
N1 K4 |
|
|
|
|