Structure of PDB 7e96 Chain B

Receptor sequence
>7e96B (length=142) Species: 55676 (Oligobrachia mashikoi) [Search protein sequence]
DCTSLNRLLVKRQWAEAYGEGTNRELLGNRIWEDLFANMPDARGLFSRVN
GNDIDSSEFQAHSLRVLGGLDMCVASLDDVPVLNALLARLNSQHDSRGIP
AAGYPAFVASAISAVRATVGARSFDNDAWNSCMNQIVSGISG
3D structure
PDB7e96 Coarse snapshots of oxygen-dissociation intermediates of a giant hemoglobin elucidated by determining the oxygen saturation in individual subunits in the crystalline state.
ChainB
Resolution2.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 HEM B F46 R48 H62 V66 Q93 H94 R97 I99 G103 Y104 F107 I140 F46 R48 H62 V66 Q93 H94 R97 I99 G103 Y104 F107 I140
BS02 OXY B W32 F46 H62 V66 W32 F46 H62 V66
Gene Ontology
Molecular Function
GO:0005344 oxygen carrier activity
GO:0005506 iron ion binding
GO:0019825 oxygen binding
GO:0020037 heme binding
GO:0046872 metal ion binding
Biological Process
GO:0015671 oxygen transport
Cellular Component
GO:0005576 extracellular region
GO:0005833 hemoglobin complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7e96, PDBe:7e96, PDBj:7e96
PDBsum7e96
PubMed34804547
UniProtQ7M413|GLBA2_OLIMA Extracellular giant hemoglobin major globin subunit A2 (Gene Name=ghbA2)

[Back to BioLiP]