Structure of PDB 7e1t Chain B

Receptor sequence
>7e1tB (length=174) Species: 9606 (Homo sapiens) [Search protein sequence]
SLFKVILLGDGGVGKSSLMNRYVTNKFDTQLFHTIGVEFLNKDLEVDGHF
VTMQIWDTAGLERFRSLRTPFYRGSDCCLLTFSVDDSQSFQNLSNWKKEF
IYYADVKEPESFPFVILGNKIDISERQVSTEEAQAWCRDNGDYPYFETSA
KDATNVAAAFEEAVRRVLATEDRS
3D structure
PDB7e1t Nde1 is a Rab9 effector for loading late endosomes to cytoplasmic dynein motor complex.
ChainB
Resolution2.45 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide B F37 H38 I40 E43 R68 F32 H33 I35 E38 R63
BS02 MG B S21 T39 S16 T34
BS03 GTP B G16 G17 V18 G19 K20 S21 S22 T34 H38 T39 G65 N124 K125 D127 I128 S154 A155 K156 G11 G12 V13 G14 K15 S16 S17 T29 H33 T34 G60 N119 K120 D122 I123 S149 A150 K151
Gene Ontology
Molecular Function
GO:0003924 GTPase activity
GO:0005515 protein binding
GO:0005525 GTP binding
GO:0019003 GDP binding
Biological Process
GO:0015031 protein transport
GO:0032482 Rab protein signal transduction
GO:0032880 regulation of protein localization
GO:0042147 retrograde transport, endosome to Golgi
GO:0045921 positive regulation of exocytosis
GO:0052403 negative regulation by host of symbiont catalytic activity
Cellular Component
GO:0000139 Golgi membrane
GO:0005764 lysosome
GO:0005768 endosome
GO:0005770 late endosome
GO:0005783 endoplasmic reticulum
GO:0005789 endoplasmic reticulum membrane
GO:0005794 Golgi apparatus
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0030133 transport vesicle
GO:0030670 phagocytic vesicle membrane
GO:0032588 trans-Golgi network membrane
GO:0042470 melanosome
GO:0045335 phagocytic vesicle
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7e1t, PDBe:7e1t, PDBj:7e1t
PDBsum7e1t
PubMed34793709
UniProtP51151|RAB9A_HUMAN Ras-related protein Rab-9A (Gene Name=RAB9A)

[Back to BioLiP]