Structure of PDB 7dwx Chain B

Receptor sequence

>7dwxB (length=748) Species: 9606 (Homo sapiens)

IEEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWS
AFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQNGSSVLSEDKSKRLNTIL
NTMSTIYSTGKVCNPDNPQECLLLEPGLNEIMANSLDYNERLWAWESWRS
EVGKQLRPLYEEYVVLKNEMARANHYEDYGDYWRGDYEVNGVDGYDYSRG
QLIEDVEHTFEEIKPLYEHLHAYVRAKLMNAYPSYISPIGCLPAHLLGDM
WGRFWTNLYSLTVPFGQKPNIDVTDAMVDQAWDAQRIFKEAEKFFVSVGL
PNMTQGFWENSMLTDPGNVQKAVCHPTAWDLGKGDFRILMCTKVTMDDFL
TAHHEMGHIQYDMAYAAQPFLLRNGANEGFHEAVGEIMSLSAATPKHLKS
IGLLSPDFQEDNETEINFLLKQALTIVGTLPFTYMLEKWRWMVFKGEIPK
DQWMKKWWEMKREIVGVVEPVPHDETYCDPASLFHVSNDYSFIRYYTRTL
YQFQFQEALCQAAKHEGPLHKCDISNSTEAGQKLFNMLRLGKSEPWTLAL
ENVVGAKNMNVRPLLNYFEPLFTWLKDQNKNSFVGWSTDWSPYADQSIKV
RISLKSALGDKAYEWNDNEMYLFRSSVAYAMRQYFLKVKNQMILFGEEDV
RVANLKPRISFNFFVTAPKNVSDIIPRTEVEKAIRMSRSRINDAFRLNDN
SLEFLGIQPTLGPPNQPPVSIWLIVFGVVMGVIVVGIVILIFTGIRDR

3D structure

• PDB: 7dwx Structural basis for the different states of the spike protein of SARS-CoV-2 in complex with ACE2.
• Chain: B
• Resolution: 8.3 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): H345 P346 H374 E375 H378 E402 H505 Y515
• Catalytic site (residue number reindexed from 1): H325 P326 H354 E355 H358 E382 H485 Y495
• Enzyme Commision number: 3.4.17.-
  3.4.17.23: angiotensin-converting enzyme 2.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	B	H374 H378 E402	H354 H358 E382

Gene Ontology

Molecular Function

• GO:0001618 virus receptor activity
• GO:0004175 endopeptidase activity
• GO:0004180 carboxypeptidase activity
• GO:0005515 protein binding
• GO:0008237 metallopeptidase activity
• GO:0008241 peptidyl-dipeptidase activity
• GO:0008270 zinc ion binding
• GO:0042802 identical protein binding
• GO:0046872 metal ion binding

Biological Process

• GO:0001817 regulation of cytokine production
• GO:0002003 angiotensin maturation
• GO:0003051 angiotensin-mediated drinking behavior
• GO:0003081 regulation of systemic arterial blood pressure by renin-angiotensin
• GO:0006508 proteolysis
• GO:0015827 tryptophan transport
• GO:0019058 viral life cycle
• GO:0019065 receptor-mediated endocytosis of virus by host cell
• GO:0019229 regulation of vasoconstriction
• GO:0022898 regulation of transmembrane transporter activity
• GO:0042127 regulation of cell population proliferation
• GO:0046718 symbiont entry into host cell
• GO:0046813 receptor-mediated virion attachment to host cell
• GO:0048662 negative regulation of smooth muscle cell proliferation
• GO:0050727 regulation of inflammatory response
• GO:0051957 positive regulation of amino acid transport
• GO:0060135 maternal process involved in female pregnancy
• GO:0060452 positive regulation of cardiac muscle contraction
• GO:0061025 membrane fusion
• GO:0070373 negative regulation of ERK1 and ERK2 cascade
• GO:0097746 blood vessel diameter maintenance
• GO:0098670 entry receptor-mediated virion attachment to host cell
• GO:1903598 positive regulation of gap junction assembly
• GO:1903779 regulation of cardiac conduction
• GO:1905737 positive regulation of L-proline import across plasma membrane
• GO:2000272 negative regulation of signaling receptor activity
• GO:2000379 positive regulation of reactive oxygen species metabolic process

Cellular Component

• GO:0005576 extracellular region
• GO:0005615 extracellular space
• GO:0005737 cytoplasm
• GO:0005788 endoplasmic reticulum lumen
• GO:0005886 plasma membrane
• GO:0005929 cilium
• GO:0009986 cell surface
• GO:0016020 membrane
• GO:0016324 apical plasma membrane
• GO:0030666 endocytic vesicle membrane
• GO:0031526 brush border membrane
• GO:0042995 cell projection
• GO:0045121 membrane raft
• GO:0070062 extracellular exosome

External links

• PDB: RCSB:7dwx, PDBe:7dwx, PDBj:7dwx
• PDBsum: 7dwx
• PubMed: 33737693
• UniProt: Q9BYF1|ACE2_HUMAN Angiotensin-converting enzyme 2 (Gene Name=ACE2)