Structure of PDB 7dt6 Chain B |
>7dt6B (length=115) Species: 9606 (Homo sapiens) [Search protein sequence] |
CPLMVKVLDAVRGSPAINVAMHVFRKAADDTWEPFASGKTSESGELHGLT TEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAA LLSPYSYSTTAVVTN |
|
PDB | 7dt6 Inhibitory activities of anthraquinone and xanthone derivatives against transthyretin amyloidogenesis. |
Chain | B |
Resolution | 1.3 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
9TF |
B |
K15 L17 A108 T119 |
K6 L8 A99 T110 |
|
|
|