Structure of PDB 7do7 Chain B

Receptor sequence

>7do7B (length=256) Species: 322710 (Azotobacter vinelandii DJ) [Search protein sequence]

SLLIDKTVIVTGASRGIGRAAARECARQGARVVIGHSGSDEGRAGALSLA
EEIAAFGGTAIAVGADAADLDSGEKLVAAAVEAFGSVDVLVNNAGICPFH
SFLDMPRELYLKTVGTNLNGAYFTVQAAARRMKEQGRGGAIIAVSSISAL
VGGAMQTHYTPTKAGLLSLMQSCAIALGPYGIRCNAVLPGTIATDINKED
LSDLEKRERMTSRVPLGRLGEPDDLAGPIVFLASDMARYVTGASLLVDGG
LFVNLQ

3D structure

PDB

7do7 Crystal structure of l-rhamnose 1-dehydrogenase involved in the nonphosphorylative pathway of l-rhamnose metabolism in bacteria.

Chain

Resolution

1.57 Å

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Catalytic site (original residue number in PDB)	G16 S146 Y159
Catalytic site (residue number reindexed from 1)	G16 S146 Y159
Enzyme Commision number	?

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	NAD	B	G12 R15 G16 I17 S37 D66 A67 N93 A94 G95 I96 V144 S145 S146 Y159 K163 P189 G190 I192 T194 I196	G12 R15 G16 I17 S37 D66 A67 N93 A94 G95 I96 V144 S145 S146 Y159 K163 P189 G190 I192 T194 I196
BS02	RM4	B	C97 F99 S146 S148 Q156 Y159 N197	C97 F99 S146 S148 Q156 Y159 N197
BS03	RM4	B	D235 M236 R238	D235 M236 R238

Gene Ontology

	Molecular Function
GO:0000166	nucleotide binding
GO:0016616	oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor

View graph for
Molecular Function

External links

PDB	RCSB:7do7, PDBe:7do7, PDBj:7do7
PDBsum	7do7
PubMed	33482017
UniProt	C1DMX5

[Back to BioLiP]