Structure of PDB 7cvq Chain B

Receptor sequence
>7cvqB (length=85) Species: 3702 (Arabidopsis thaliana) [Search protein sequence]
DRFLPIANVSRIMKKALPANAKISKDAKETMQECVSEFISFVTGEASDKC
QKEKRKTINGDDLLWAMTTLGFEDYVEPLKVYLQR
3D structure
PDB7cvq Structural insights into the multivalent binding of the Arabidopsis FLOWERING LOCUS T promoter by the CO-NF-Y master transcription factor complex.
ChainB
Resolution3.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna B I34 A35 N36 R39 I6 A7 N8 R11
BS02 dna B I51 S52 R83 K84 I23 S24 R55 K56
Gene Ontology
Molecular Function
GO:0001228 DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0005634 nucleus
GO:0016602 CCAAT-binding factor complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7cvq, PDBe:7cvq, PDBj:7cvq
PDBsum7cvq
PubMed33693873
UniProtQ9FGJ3|NFYB2_ARATH Nuclear transcription factor Y subunit B-2 (Gene Name=NFYB2)

[Back to BioLiP]