Structure of PDB 7crq Chain B |
>7crqB (length=82) Species: 8355 (Xenopus laevis) [Search protein sequence] |
KVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDA VTYTEHAKRKTVTAMDVVYALKRQGRTLYGFG |
|
PDB | 7crq Molecular basis of nucleosomal H3K36 methylation by NSD methyltransferases. |
Chain | B |
Resolution | 3.15 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
dna |
B |
R45 I46 T80 |
R26 I27 T61 |
|
|
|
|