Structure of PDB 7cqp Chain B

Receptor sequence
>7cqpB (length=75) Species: 10090 (Mus musculus) [Search protein sequence]
QLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMI
NEVDADGNGTIDFPEFLTMMARKMK
3D structure
PDB7cqp Calmodulin binds to Drosophila TRP with an unexpected mode.
ChainB
Resolution1.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide B Q9 E12 F13 E15 A16 L19 F20 L33 M37 L40 M52 F69 M72 M73 K76 Q6 E9 F10 E12 A13 L16 F17 L30 M34 L37 M49 F66 M69 M70 K73
BS02 CA B D57 D59 N61 T63 E68 D54 D56 N58 T60 E65
BS03 CA B D21 D23 D25 T27 E32 D18 D20 D22 T24 E29
Gene Ontology
Molecular Function
GO:0005509 calcium ion binding

View graph for
Molecular Function
External links
PDB RCSB:7cqp, PDBe:7cqp, PDBj:7cqp
PDBsum7cqp
PubMed33326749
UniProtP0DP26|CALM1_MOUSE Calmodulin-1 (Gene Name=Calm1)

[Back to BioLiP]