Structure of PDB 7cn6 Chain B |
>7cn6B (length=75) Species: 10665 (Tequatrovirus T4) [Search protein sequence] |
GYDKDLCEWSMTADQTEVETQIEADIMNIVKRDRPEMKAEVQKQLKSGGV MQYNYVLYCDKNFNNKNIIAEVVGE |
|
PDB | 7cn6 Structure and Function of the T4 Spackle Protein Gp61.3. |
Chain | B |
Resolution | 1.6 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CA |
B |
V94 E97 |
V72 E75 |
|
|
|
|