Structure of PDB 7cci Chain B |
>7cciB (length=134) Species: 470 (Acinetobacter baumannii) [Search protein sequence] |
HHFDHSFSFDCQDKVILVVEDDYDIGDIIENYLKREGMSVIRAMNGKQAI ELHASQPIDLILLDIKLPELNGWEVLNKIRQKAQTPVIMLTALDQDIDKV MALRIGADDFVVAPFNPNEVIARVQAVLRRTQFA |
|
PDB | 7cci Proteolysis and multimerization regulate signaling along the two-component regulatory system AdeRS. |
Chain | B |
Resolution | 1.65 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
MG |
B |
E19 D20 D63 |
E20 D21 D64 |
|
|
|
|