Structure of PDB 7ca0 Chain B

Receptor sequence

>7ca0B (length=364) Species: 559292 (Saccharomyces cerevisiae S288C)

VQEIDLGLTCDMHVHVREGAMCELVTPKIRDGGVSIAYIMPNLQPPITTL
DRVIEYKKTLQKLAPKTTFLMSFYLSKDLTPDLIHEAAQQHAIRGVKCYP
AGVTTNSAAGVDPNDFSAFYPIFKAMQEENLVLNLHGEKPSVHDGDKEPI
HVLNAEEAFLPALKKLHNDFPNLKIILEHCTSESAIKTIEDINKNVKKAT
DVKVAATLTAHHLFLTIDDWAGNPVNFCKPVAKLPNDKKALVKAAVSGKP
YFFFGSDSAPHPVQNKANYEGVCAGVYSQSFAIPYIAQVFEEQNALENLK
GFVSDFGISFYEVKDSEVASSDKAILFKKEQVIPQVISDGKDISIIPFKA
GDKLSWSVRWEPRL

3D structure

• PDB: 7ca0 Complexed Crystal Structure of Saccharomyces cerevisiae Dihydroorotase with Inhibitor 5-Fluoroorotate Reveals a New Binding Mode.
• Chain: B
• Resolution: 2.5 Å

Enzymatic activity

• Enzyme Commision number: 3.5.2.3: dihydroorotase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	B	H14 H16 K98 D258	H13 H15 K97 D257
BS02	ZN	B	K98 H137 H180	K97 H136 H179
BS03	FOT	B	H16 R18 N43 K98 T105 T106 D258 A260 A275	H15 R17 N42 K97 T104 T105 D257 A259 A274

Gene Ontology

Molecular Function

• GO:0004151 dihydroorotase activity
• GO:0008270 zinc ion binding
• GO:0016787 hydrolase activity
• GO:0016812 hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in cyclic amides
• GO:0046872 metal ion binding

Biological Process

• GO:0006207 'de novo' pyrimidine nucleobase biosynthetic process
• GO:0006221 pyrimidine nucleotide biosynthetic process
• GO:0019856 pyrimidine nucleobase biosynthetic process
• GO:0044205 'de novo' UMP biosynthetic process

Cellular Component

• GO:0005634 nucleus
• GO:0005737 cytoplasm

External links

• PDB: RCSB:7ca0, PDBe:7ca0, PDBj:7ca0
• PDBsum: 7ca0
• PubMed: 34630544
• UniProt: P20051|PYRC_YEAST Dihydroorotase (Gene Name=URA4)