Structure of PDB 7c9i Chain B

Receptor sequence
>7c9iB (length=307) Species: 9606 (Homo sapiens) [Search protein sequence]
KYGAKHVIMLFVPVTLCMVVVVATIKSVSFYTRKDGQLIYTPFTEDTETV
GQRALHSILNAAIMISVIVVMTILLVVLYKYRCYKVIHAWLIISSLLLLF
FFSFIYLGEVFKTYNVAVDYITVALLIWNFGVVGMISIHWKGPLRLQQAY
LIMISALMALVFIKYLPEWTAWLILAVISVYDLVAVLCPKGPLRMLVETA
QERNETLFPALIYSSTRGVKLGLGDFIFYSVLVGKASATASGDWNTTIAC
FVAILIGLCLTLLLLAIFKKALPALPISITFGLVFYFATDYLVQPFMDQL
AFHQFYI
3D structure
PDB7c9i Structural basis of gamma-secretase inhibition and modulation by small molecule drugs.
ChainB
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 3.4.23.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 FTO B D257 V272 L286 K380 G382 G384 D385 F388 L432 A434 L435 D182 V197 L211 K220 G222 G224 D225 F228 L272 A274 L275 BindingDB: IC50=36nM
Gene Ontology
Molecular Function
GO:0004175 endopeptidase activity
GO:0004190 aspartic-type endopeptidase activity
GO:0005262 calcium channel activity
GO:0005515 protein binding
GO:0008013 beta-catenin binding
GO:0008233 peptidase activity
GO:0030165 PDZ domain binding
GO:0042500 aspartic endopeptidase activity, intramembrane cleaving
GO:0045296 cadherin binding
GO:0051117 ATPase binding
GO:0070851 growth factor receptor binding
Biological Process
GO:0000045 autophagosome assembly
GO:0000122 negative regulation of transcription by RNA polymerase II
GO:0001568 blood vessel development
GO:0001708 cell fate specification
GO:0001756 somitogenesis
GO:0001764 neuron migration
GO:0001921 positive regulation of receptor recycling
GO:0001947 heart looping
GO:0002038 positive regulation of L-glutamate import across plasma membrane
GO:0002244 hematopoietic progenitor cell differentiation
GO:0002265 astrocyte activation involved in immune response
GO:0002286 T cell activation involved in immune response
GO:0002573 myeloid leukocyte differentiation
GO:0003407 neural retina development
GO:0006486 protein glycosylation
GO:0006508 proteolysis
GO:0006509 membrane protein ectodomain proteolysis
GO:0006839 mitochondrial transport
GO:0006874 intracellular calcium ion homeostasis
GO:0006914 autophagy
GO:0006915 apoptotic process
GO:0006974 DNA damage response
GO:0006979 response to oxidative stress
GO:0007155 cell adhesion
GO:0007175 negative regulation of epidermal growth factor-activated receptor activity
GO:0007219 Notch signaling pathway
GO:0007220 Notch receptor processing
GO:0007420 brain development
GO:0007507 heart development
GO:0007611 learning or memory
GO:0007613 memory
GO:0009791 post-embryonic development
GO:0010467 gene expression
GO:0010468 regulation of gene expression
GO:0010628 positive regulation of gene expression
GO:0010629 negative regulation of gene expression
GO:0010975 regulation of neuron projection development
GO:0015031 protein transport
GO:0015871 choline transport
GO:0016080 synaptic vesicle targeting
GO:0016485 protein processing
GO:0021549 cerebellum development
GO:0021795 cerebral cortex cell migration
GO:0021870 Cajal-Retzius cell differentiation
GO:0021904 dorsal/ventral neural tube patterning
GO:0021987 cerebral cortex development
GO:0022008 neurogenesis
GO:0030182 neuron differentiation
GO:0030326 embryonic limb morphogenesis
GO:0030900 forebrain development
GO:0032436 positive regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:0032469 endoplasmic reticulum calcium ion homeostasis
GO:0032760 positive regulation of tumor necrosis factor production
GO:0034205 amyloid-beta formation
GO:0035282 segmentation
GO:0035556 intracellular signal transduction
GO:0040011 locomotion
GO:0042307 positive regulation of protein import into nucleus
GO:0042325 regulation of phosphorylation
GO:0042982 amyloid precursor protein metabolic process
GO:0042987 amyloid precursor protein catabolic process
GO:0043011 myeloid dendritic cell differentiation
GO:0043065 positive regulation of apoptotic process
GO:0043066 negative regulation of apoptotic process
GO:0043524 negative regulation of neuron apoptotic process
GO:0043589 skin morphogenesis
GO:0045821 positive regulation of glycolytic process
GO:0045893 positive regulation of DNA-templated transcription
GO:0048143 astrocyte activation
GO:0048167 regulation of synaptic plasticity
GO:0048538 thymus development
GO:0048666 neuron development
GO:0048705 skeletal system morphogenesis
GO:0048854 brain morphogenesis
GO:0050435 amyloid-beta metabolic process
GO:0050673 epithelial cell proliferation
GO:0050771 negative regulation of axonogenesis
GO:0050808 synapse organization
GO:0050820 positive regulation of coagulation
GO:0050852 T cell receptor signaling pathway
GO:0051208 sequestering of calcium ion
GO:0051402 neuron apoptotic process
GO:0051444 negative regulation of ubiquitin-protein transferase activity
GO:0051563 smooth endoplasmic reticulum calcium ion homeostasis
GO:0051604 protein maturation
GO:0051966 regulation of synaptic transmission, glutamatergic
GO:0055074 calcium ion homeostasis
GO:0060075 regulation of resting membrane potential
GO:0060828 regulation of canonical Wnt signaling pathway
GO:0060999 positive regulation of dendritic spine development
GO:0070050 neuron cellular homeostasis
GO:0070588 calcium ion transmembrane transport
GO:0097190 apoptotic signaling pathway
GO:0098609 cell-cell adhesion
GO:0098693 regulation of synaptic vesicle cycle
GO:0098712 L-glutamate import across plasma membrane
GO:0099175 regulation of postsynapse organization
GO:0140249 protein catabolic process at postsynapse
GO:1904646 cellular response to amyloid-beta
GO:1904797 negative regulation of core promoter binding
GO:1905598 negative regulation of low-density lipoprotein receptor activity
GO:1905908 positive regulation of amyloid fibril formation
GO:1990535 neuron projection maintenance
GO:2000059 negative regulation of ubiquitin-dependent protein catabolic process
GO:2001234 negative regulation of apoptotic signaling pathway
Cellular Component
GO:0000139 Golgi membrane
GO:0000776 kinetochore
GO:0005634 nucleus
GO:0005640 nuclear outer membrane
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005765 lysosomal membrane
GO:0005768 endosome
GO:0005769 early endosome
GO:0005783 endoplasmic reticulum
GO:0005789 endoplasmic reticulum membrane
GO:0005790 smooth endoplasmic reticulum
GO:0005791 rough endoplasmic reticulum
GO:0005794 Golgi apparatus
GO:0005813 centrosome
GO:0005886 plasma membrane
GO:0005938 cell cortex
GO:0008021 synaptic vesicle
GO:0009986 cell surface
GO:0016020 membrane
GO:0016235 aggresome
GO:0030054 cell junction
GO:0030424 axon
GO:0030425 dendrite
GO:0030426 growth cone
GO:0031410 cytoplasmic vesicle
GO:0031594 neuromuscular junction
GO:0031901 early endosome membrane
GO:0031965 nuclear membrane
GO:0032991 protein-containing complex
GO:0035253 ciliary rootlet
GO:0035577 azurophil granule membrane
GO:0042383 sarcolemma
GO:0042734 presynaptic membrane
GO:0042995 cell projection
GO:0043005 neuron projection
GO:0043025 neuronal cell body
GO:0043198 dendritic shaft
GO:0045121 membrane raft
GO:0045202 synapse
GO:0070765 gamma-secretase complex
GO:0097060 synaptic membrane
GO:0098794 postsynapse
GO:0098978 glutamatergic synapse

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7c9i, PDBe:7c9i, PDBj:7c9i
PDBsum7c9i
PubMed33373587
UniProtP49768|PSN1_HUMAN Presenilin-1 (Gene Name=PSEN1)

[Back to BioLiP]