Structure of PDB 7c8e Chain B

Receptor sequence
>7c8eB (length=230) Species: 9606 (Homo sapiens) [Search protein sequence]
DREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNV
IGARRASWRIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDILD
VLDKHLIPAANTGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAY
KAASDIAMTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDA
IAELDTLSEESYKDSTLIMQLLRDNLTLWT
3D structure
PDB7c8e Target identification for small-molecule discovery in the FOXO3a tumor-suppressor pathway using a biodiverse peptide library.
ChainB
Resolution3.16 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide B R57 R61 K123 R130 Y131 N176 E183 I220 L223 D226 N227 R55 R59 K121 R128 Y129 N174 E181 I218 L221 D224 N225
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005246 calcium channel regulator activity
GO:0005515 protein binding
GO:0015459 potassium channel regulator activity
GO:0019855 calcium channel inhibitor activity
GO:0019899 enzyme binding
GO:0019903 protein phosphatase binding
GO:0019904 protein domain specific binding
GO:0023026 MHC class II protein complex binding
GO:0031625 ubiquitin protein ligase binding
GO:0035591 signaling adaptor activity
GO:0042802 identical protein binding
GO:0042826 histone deacetylase binding
GO:0044325 transmembrane transporter binding
GO:0045296 cadherin binding
GO:0046982 protein heterodimerization activity
GO:0050815 phosphoserine residue binding
GO:0051219 phosphoprotein binding
GO:0097110 scaffold protein binding
GO:0140311 protein sequestering activity
Biological Process
GO:0000165 MAPK cascade
GO:0001764 neuron migration
GO:0002753 cytoplasmic pattern recognition receptor signaling pathway
GO:0003064 regulation of heart rate by hormone
GO:0006605 protein targeting
GO:0007165 signal transduction
GO:0007346 regulation of mitotic cell cycle
GO:0008104 protein localization
GO:0021762 substantia nigra development
GO:0021766 hippocampus development
GO:0021987 cerebral cortex development
GO:0034122 negative regulation of toll-like receptor signaling pathway
GO:0034504 protein localization to nucleus
GO:0034605 cellular response to heat
GO:0035332 positive regulation of hippo signaling
GO:0035556 intracellular signal transduction
GO:0046827 positive regulation of protein export from nucleus
GO:0051220 cytoplasmic sequestering of protein
GO:0051480 regulation of cytosolic calcium ion concentration
GO:0060306 regulation of membrane repolarization
GO:0070972 protein localization to endoplasmic reticulum
GO:0086013 membrane repolarization during cardiac muscle cell action potential
GO:0086091 regulation of heart rate by cardiac conduction
GO:1901016 regulation of potassium ion transmembrane transporter activity
GO:1905913 negative regulation of calcium ion export across plasma membrane
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005783 endoplasmic reticulum
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0005925 focal adhesion
GO:0016020 membrane
GO:0031966 mitochondrial membrane
GO:0042470 melanosome
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7c8e, PDBe:7c8e, PDBj:7c8e
PDBsum7c8e
PubMed34111400
UniProtP62258|1433E_HUMAN 14-3-3 protein epsilon (Gene Name=YWHAE)

[Back to BioLiP]