Structure of PDB 7bww Chain B |
>7bwwB (length=88) Species: 32630 (synthetic construct) [Search protein sequence] |
GSPLAQQIKNILSLISQADAAGRMDEVRTLQLNLCQLMVEYFQGSPLAQQ IKNIHSFGHQAWAAGRLDEVLTIQENLYQLMKEYFQQS |
|
PDB | 7bww Efficient Lewis acid catalysis of an abiological reaction in a de novo protein scaffold. |
Chain | B |
Resolution | 1.5 Å |
3D structure |
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
B |
C35 H61 H65 |
C35 H55 H59 |
|
|
|